Search results for " Fluid"

showing 10 items of 3232 documents

Hyperfine interaction in the Autler-Townes effect: The formation of bright, dark, and chameleon states

2017

This paper is devoted to clarifying the implications of hyperfine (HF) interaction in the formation of adiabatic (i.e., ``laser-dressed'') states and their expression in the Autler-Townes (AT) spectra. We first use the Morris-Shore model [J. R. Morris and B. W. Shore, Phys. Rev. A 27, 906 (1983)] to illustrate how bright and dark states are formed in a simple reference system where closely spaced energy levels are coupled to a single state with a strong laser field with the respective Rabi frequency ${\mathrm{\ensuremath{\Omega}}}_{S}$. We then expand the simulations to realistic hyperfine level systems in Na atoms for a more general case when non-negligible HF interaction can be treated as…

PhysicsAutler–Townes effectCoupling (probability)01 natural sciencesOmegaSpectral line010305 fluids & plasmas0103 physical sciencesAtomic physics010306 general physicsGround stateHyperfine structureEnergy (signal processing)ExcitationPhysical Review A
researchProduct

Aircraft wing rock oscillations suppression by simple adaptive control

2020

Abstract Roll angular motion of the modern aircraft operating in non-linear flight modes with a high angle of attack often demonstrates the limit cycle oscillations, which is commonly known as the wing rock phenomenon. Wing rock dynamics are represented by a substantially non-linear model, with parameters varying over a wide range, depending on the flight conditions (altitude, Mach number, payload mass, etc.) and angle of attack. A perspective approach of the wing rock suppression lies in the adaptation methods. In the present paper an application of the simple adaptive control approach with the Implicit Reference Model (IRM) is proposed and numerically studied. The IRM adaptive controller …

0209 industrial biotechnologyAdaptive controlComputer scienceAngle of attackAerospace Engineering02 engineering and technology01 natural sciences010305 fluids & plasmaslaw.inventionsymbols.namesake020901 industrial engineering & automationCircular motionAileronMach numberControl theorylawRange (aeronautics)0103 physical sciencesTrajectorysymbolsAerospace Science and Technology
researchProduct

Piezoelectric Actuated Nonlinear Energy Sink With Tunable Attenuation Efficiency

2019

Abstract Comparing to linear vibration absorbers, nonlinear energy sinks (NESs) have attracted worldwide attention for their intrinsic characteristics of targeted energy transfer or energy pumping in a relatively wide frequency range. Unfortunately, they are highly dependent on the vibration amplitude to be attenuated and will play its role only if the external load exceeds a specific threshold value. Different from the passive bistable NES, a novel piezoelectric nonlinear energy sink (PNES) is designed by introducing in-phase actuation to compensate or enhance the external vibration loads, thus triggering the NES operating in high attenuation efficiency. The nonlinear mathematic model of t…

Physicsgeographygeography.geographical_feature_categoryCantileverbusiness.industryMechanical EngineeringAttenuationCondensed Matter Physics01 natural sciencesPiezoelectricitySink (geography)010305 fluids & plasmasNonlinear systemMechanics of Materials0103 physical sciencesOptoelectronicsbusiness010301 acousticsExcitationJournal of Applied Mechanics
researchProduct

A 12-year-old boy with severe back pain and blast-like cells in the CSF

1999

Malemedicine.medical_specialtyLumbar Vertebraebusiness.industryLymphoblastCentral nervous systemBack anatomyMagnetic Resonance ImagingSurgeryCerebrospinal fluidmedicine.anatomical_structureEl NiñoBack PainPediatrics Perinatology and Child HealthmedicineHumansSevere back painLymphocytesBorrelia InfectionsChildbusinessEuropean Journal of Pediatrics
researchProduct

Rydberg excitation of trapped cold ions: a detailed case study

2011

We provide a detailed theoretical and conceptual study of a planned experiment to excite Rydberg states of ions trapped in a Paul trap. The ultimate goal is to exploit the strong state dependent interactions between Rydberg ions to implement quantum information processing protocols and to simulate the dynamics of strongly interacting spin systems. We highlight the promises of this approach when combining the high degree of control and readout of quantum states in trapped ion crystals with the novel and fast gate schemes based on interacting giant Rydberg atomic dipole moments. We discuss anticipated theoretical and experimental challenges on the way towards its realization.

PhysicsQuantum PhysicsAtomic Physics (physics.atom-ph)FOS: Physical sciencesGeneral Physics and Astronomy01 natural sciencesPhysics - Atomic Physics010305 fluids & plasmasIonsymbols.namesakeDipoleQuantum state0103 physical sciencesRydberg formulasymbolsPhysics::Atomic PhysicsIon trapAtomic physicsQuantum Physics (quant-ph)010306 general physicsSpin (physics)Realization (systems)ExcitationNew Journal of Physics
researchProduct

Non-eosinophilic Airway Hyper-reactivity in Mice, Induced by IFN-γProducing CD4+and CD8+Lung T cells, is Responsive to Steroid Treatment

2014

Non-eosinophilic asthma is characterized by infiltration of neutrophils into the lung and variable responsiveness to glucocorticoids. The pathophysiological mechanisms have not been characterized in detail. Here, we present an experimental asthma model in mice associated with non-eosinophilic airway inflammation and airway hyper-responsiveness (AHR). For this, BALB/c mice were sensitized by biolistic DNA immunization with a plasmid encoding the model antigen β-galactosidase (pFascin-βGal mice). For comparison, eosinophilic airway inflammation was induced by subcutaneous injection of βGal protein (βGal mice). Intranasal challenge of mice in both groups induced AHR to a comparable extent as w…

NeutrophilsImmunologyInflammationBiologyLymphocyte ActivationDexamethasoneLymphocyte DepletionInterferon-gammaMiceTh2 CellsAntigenmedicineAnimalsLungDexamethasoneMice Inbred BALB CLungDNAGeneral MedicineBiolisticsTh1 Cellsrespiratory systembeta-Galactosidasemedicine.diseaseAsthmaNeutrophiliarespiratory tract diseasesEosinophilsDisease Models Animalmedicine.anatomical_structureNeutrophil InfiltrationImmunologyTh17 CellsFemaleGoblet Cellsmedicine.symptomBronchoalveolar Lavage FluidInfiltration (medical)CD8GlucocorticoidT-Lymphocytes Cytotoxicmedicine.drugScandinavian Journal of Immunology
researchProduct

Protecting quantum resources via frequency modulation of qubits in leaky cavities

2018

Finding strategies to preserve quantum resources in open systems is nowadays a main requirement for reliable quantum-enhanced technologies. We address this issue by considering structured cavities embedding qubits driven by a control technique known as frequency modulation. We first study a single qubit in a lossy cavity to determine optimal modulation parameters and qubit-cavity coupling regime allowing a gain of four orders of magnitude concerning coherence lifetimes. We relate this behavior to the inhibition of the qubit effective decay rate rather than to stronger memory effects (non-Markovianity) of the system. We then exploit these findings in a system of noninteracting qubits embedde…

Quantum PhysicsMultidisciplinaryQuantum decoherenceComputer sciencelcsh:Rlcsh:MedicineFOS: Physical sciencesQuantum entanglementTopology01 natural sciencesSettore FIS/03 - Fisica Della Materia010305 fluids & plasmasEntanglement open quantum systems protection of quantum correlations frequency modulationQubit0103 physical scienceslcsh:Qlcsh:Science010306 general physicsQuantum Physics (quant-ph)QuantumFrequency modulationCoherence (physics)Quantum computer
researchProduct

Systematic review: progression of beryllium sensitization to chronic beryllium disease

2012

BACKGROUND The relevance of beryllium sensitization testing for occupational health practice and prevention is unclear. AIMS To analyse the natural course of beryllium sensitization and clarify the prognosis following cessation of exposure among sensitized workers. METHODS An electronic literature search was conducted in PubMed, Embase, Toxline and Cochrane databases supplemented by a manual search. Data abstraction and study quality assessment with adapted guideline checklists were performed independently by three reviewers. Seven studies met the eligibility criteria and were included in the systematic review; however, six of the seven studies were of low methodological quality. RESULTS A …

Malemedicine.medical_specialtyPathologychemistry.chemical_elementAir Pollutants OccupationalLymphocyte ActivationOccupational safety and healthBerylliosisGermanyOccupational ExposuremedicineHumansIntensive care medicineContinuous exposureProspective cohort studySensitizationRadioisotopesData abstractionbusiness.industryPublic Health Environmental and Occupational HealthGuidelinePrognosisrespiratory tract diseasesOccupational Diseasesmedicine.anatomical_structurechemistryChronic DiseaseDisease ProgressionFemaleBerylliumBerylliumbusinessBronchoalveolar Lavage FluidBeryllium DiseaseOccupational Medicine
researchProduct

Impacts of Varying Concentrations of Cloud Condensation Nuclei on Deep Convective Cloud Updrafts—A Multimodel Assessment

2021

AbstractThis study presents results from a model intercomparison project, focusing on the range of responses in deep convective cloud updrafts to varying cloud condensation nuclei (CCN) concentrations among seven state-of-the-art cloud-resolving models. Simulations of scattered convective clouds near Houston, Texas, are conducted, after being initialized with both relatively low and high CCN concentrations. Deep convective updrafts are identified, and trends in the updraft intensity and frequency are assessed. The factors contributing to the vertical velocity tendencies are examined to identify the physical processes associated with the CCN-induced updraft changes. The models show several c…

Convection[SDU.OCEAN]Sciences of the Universe [physics]/Ocean AtmosphereAtmospheric ScienceBuoyancy010504 meteorology & atmospheric sciencesPerturbation (astronomy)engineering.materialAtmospheric sciences01 natural sciences010305 fluids & plasmasTroposphere13. Climate action0103 physical sciencesConvective cloudengineeringCloud condensation nucleiEnvironmental scienceIntensity (heat transfer)Pressure gradient0105 earth and related environmental sciences
researchProduct

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct